Product Details 

 


  Impulse 7X Power Pak with Bullet
DESCRIPTION: Discreet, versatile HyperSonic bullet with 7-independent functions of vibration, random sequence and pulsation. State-of-the-art LED display. 3 AA batteries (not included). Category:eggs bullets Powered by: 3 AA Color:Red Vibration:VibratesMulti-SpeedHi-TechPulsating
  Related Products, Click here: Batteries, Order the Best! Energizer
    


Quantity:

  Our Price: $33.80 
Color:
Red  
Inventory:30
Sku#:SE0053-10 

Help & FAQ?

 

Category:egg_bullet     Our Product ID:111    
Our Price: $33.80  Red Availability: Usually we ship your items the same business day.

The Toys in this site are for use by consenting adults as novelties, fashion accessories, bondage, role play and sexual toys. thediscountsextoys.com assumes no responsibility for unsafe, improper, or illegal use of these items.
You are now checking out through our Secure Server. All data transferred between your browser
and our store will be encrypted.
however if you wish to make your purchase offline click here

 
Why Buy From Us?
  • We Help Put The Spark Back into Your Life
      
      with Our Unique Quality Sex Toys, Vibrators, Dildos,
         Accessories, Sex Lingerie, Straps, Lubricants to make
         It Run Smoothly! All which have been carefully Chosen.
  •   Unbeatable prices guaranteed!
  •   Secure Ordering Online 100% secure encrypted website
     
       with plain discreet Unmarked Packaging!
  •   Your privacy is guaranteed!
  •   Free shipping with over $99 of order
  •   Next day delivery on most items
  •   Track the progress / status of your orders by Logging-In
         to your account
  • Unique Coupons, Satisfaction guaranteed! 
  •  No Limits to our Excellence
  •  Join thousands of satisfied customers  
Click for more Testimonials
I had to call customer service for some help and the man who answered the phone was wonderful. He was so helpful and he stayed on the phone until I found just what I needed. Excellent service. I will definitely be telling everyone about your site
  100% Discreet Billing, 100% Discreet Shipping, No Junk Mail, Discount Prices.


contact uslinksaffiliatesprivacydiscreet shipping &billing
Copyright © 2004 thediscountsextoys.com
 All Rights Reserved