Product Details 

 


  Next Generation Impulse TechnoBeat Dolphin
DESCRIPTION: Innovative LCD back-lit graphics display with 7 Hypersonic functions of intensity, sequenced to the digital graphics monitor creating visual as well as amplified stimulating sensations. Hpersonic functions of vibration, pulsation and random sequence with 9 levels of vibration intensity. Versatile, dscreet, micro-sized, Jelly arouser with adjustable straps. May be worn all day and during lovemaking. Plug in jack. Uses 3 AAA batteries (not included)
  Related Products, Click here: Batteries, Order the Best! Energizer
    


Quantity:

  Our Price: $58.40 
Color:
Blue, Pink  
Inventory:30
Sku#:SE0042-12 

Help & FAQ?

 

Category:strapsons_vibe     Our Product ID:103    
Our Price: $58.40  Blue, Pink Availability: Usually we ship your items the same business day.

The Toys in this site are for use by consenting adults as novelties, fashion accessories, bondage, role play and sexual toys. thediscountsextoys.com assumes no responsibility for unsafe, improper, or illegal use of these items.
You are now checking out through our Secure Server. All data transferred between your browser
and our store will be encrypted.
however if you wish to make your purchase offline click here

 
Why Buy From Us?
  • We Help Put The Spark Back into Your Life
      
      with Our Unique Quality Sex Toys, Vibrators, Dildos,
         Accessories, Sex Lingerie, Straps, Lubricants to make
         It Run Smoothly! All which have been carefully Chosen.
  •   Unbeatable prices guaranteed!
  •   Secure Ordering Online 100% secure encrypted website
     
       with plain discreet Unmarked Packaging!
  •   Your privacy is guaranteed!
  •   Free shipping with over $99 of order
  •   Next day delivery on most items
  •   Track the progress / status of your orders by Logging-In
         to your account
  • Unique Coupons, Satisfaction guaranteed! 
  •  No Limits to our Excellence
  •  Join thousands of satisfied customers  
Click for more Testimonials
I had to call customer service for some help and the man who answered the phone was wonderful. He was so helpful and he stayed on the phone until I found just what I needed. Excellent service. I will definitely be telling everyone about your site
  100% Discreet Billing, 100% Discreet Shipping, No Junk Mail, Discount Prices.


contact uslinksaffiliatesprivacydiscreet shipping &billing
Copyright © 2004 thediscountsextoys.com
 All Rights Reserved